STRA8 Antibody
| Name | STRA8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13397 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCA NTQVKQEASFPVDEEMIMLQC |
| Description | Rabbit Polyclonal |
| Gene | STRA8 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: STRA8 Antibody [NBP2-13397] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25004_STRA8-Antibody-Immunohistochemistry-NBP2-13397-img0002.jpg)
Immunohistochemistry: STRA8 Antibody [NBP2-13397] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.