TSG-9 Antibody
| Name | TSG-9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13495 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGD KEEQPLQEPDSGLRSRDSEPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TSG-9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TUSC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TSG-9 Antibody [NBP2-13495] - Staining of human testis shows nuclear positivity in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19683_TSG-9%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13495-img0002.jpg)
Immunohistochemistry-Paraffin: TSG-9 Antibody [NBP2-13495] - Staining of human testis shows nuclear positivity in seminiferous ducts.