TPPP3 Antibody
| Name | TPPP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13469 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: ATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TPPP3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TPPP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TPPP3 Antibody [NBP2-13469] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10844_TPPP3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13469-img0003.jpg)
Immunocytochemistry/Immunofluorescence: TPPP3 Antibody [NBP2-13469] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center.
![Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10845_TPPP3-Antibody-Immunohistochemistry-Paraffin-NBP2-13469-img0001.jpg)
Immunohistochemistry-Paraffin: TPPP3 Antibody [NBP2-13469] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.