TOMM40L Antibody
| Name | TOMM40L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13463 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGD M |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TOMM40L Protein |
| Description | Rabbit Polyclonal |
| Gene | TOMM40L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TOMM40L Antibody [NBP2-13463] Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4197_TOMM40L%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13463-img0001.jpg)
Immunohistochemistry-Paraffin: TOMM40L Antibody [NBP2-13463] Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.