TMEM38A Antibody
| Name | TMEM38A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13452 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-F IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMP AKSKEELSEGSRKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TMEM38A Protein |
| Description | Rabbit Polyclonal |
| Gene | TMEM38A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14536_TMEM38A-Antibody-Immunohistochemistry-Paraffin-NBP2-13452-img0002.jpg)
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
![Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14537_TMEM38A-Antibody-Immunohistochemistry-Paraffin-NBP2-13452-img0001.jpg)
Immunohistochemistry-Paraffin: TMEM38A Antibody [NBP2-13452] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
![Immunohistochemistry-Frozen: TMEM38A Antibody [NBP2-13452] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14538_TMEM38A%2520Antibody-Immunohistochemistry-Frozen-NBP2-13452-img0003.jpg)
Immunohistochemistry-Frozen: TMEM38A Antibody [NBP2-13452] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)