TM2D1 Antibody
| Name | TM2D1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13436 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNE THFTGNEVGFFKPISCRNVNG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TM2D1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TM2D1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TM2D1 Antibody [NBP2-13436] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9887_TM2D1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13436-img0003.jpg)
Immunocytochemistry/Immunofluorescence: TM2D1 Antibody [NBP2-13436] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: TM2D1 Antibody [NBP2-13436] - Staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9888_TM2D1-Antibody-Immunohistochemistry-Paraffin-NBP2-13436-img0001.jpg)
Immunohistochemistry-Paraffin: TM2D1 Antibody [NBP2-13436] - Staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.