TIAF1 Antibody

Name TIAF1 Antibody
Supplier Novus Biologicals
Catalog NBP2-13430
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYAD KCV
Purity/Format Immunogen affinity purified
Blocking Peptide TIAF1 Protein
Description Rabbit Polyclonal
Gene TIAF1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.