TFAP2D Antibody
| Name | TFAP2D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13428 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRK TSEAAVKEGK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TFAP2D Protein |
| Description | Rabbit Polyclonal |
| Gene | TFAP2D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TFAP2D Antibody [NBP2-13428] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14532_TFAP2D%2520Antibody-Western%2520Blot-NBP2-13428-img0003.jpg)
Western Blot: TFAP2D Antibody [NBP2-13428] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
![Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14533_TFAP2D-Antibody-Immunohistochemistry-Paraffin-NBP2-13428-img0002.jpg)
Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.