TEKT4 Antibody
| Name | TEKT4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13425 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-F IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAQTVPPCELPCKEYDVARNTGAYTSSGLATASFRTSKYLLEEWFQNCYA RYHQAFADRDQSERQRHESQQLATETQA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TEKT4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TEKT4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Frozen: TEKT4 Antibody [NBP2-13425] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408173)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26792_TEKT4%2520Antibody-Immunohistochemistry-Frozen-NBP2-13425-img0002.jpg)
Immunohistochemistry-Frozen: TEKT4 Antibody [NBP2-13425] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408173)
![Immunohistochemistry-Paraffin: TEKT4 Antibody [NBP2-13425] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26793_TEKT4-Antibody-Immunohistochemistry-Paraffin-NBP2-13425-img0001.jpg)
Immunohistochemistry-Paraffin: TEKT4 Antibody [NBP2-13425] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.