TCTEX1D2 Antibody
| Name | TCTEX1D2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13422 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDAD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TCTEX1D2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TCTEX1D2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: TCTEX1D2 Antibody [NBP2-13422] - Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9840_TCTEX1D2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13422-img0004.jpg)
![Immunohistochemistry-Paraffin: TCTEX1D2 Antibody [NBP2-13422] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9841_TCTEX1D2-Antibody-Immunohistochemistry-Paraffin-NBP2-13422-img0002.jpg)