Zinc finger protein 395 Antibody
| Name | Zinc finger protein 395 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13570 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: APQPFTTSDDTPCQEQPKEVLKAPSTSGLQQVAFQPGQKVYVWYGGQECT GLVEQHSWMEGQVTVWLLEQKLQVCCRVE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Zinc finger protein 395 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZNF395 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Zinc finger protein 395 Antibody [NBP2-13570] Staining of human epididymis shows strong positivity in the lumen whereas glandular cells displayed moderate cytoplasmic and membranous positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25043_Zinc%2520finger%2520protein%2520395%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13570-img0001.jpg)
Immunohistochemistry-Paraffin: Zinc finger protein 395 Antibody [NBP2-13570] Staining of human epididymis shows strong positivity in the lumen whereas glandular cells displayed moderate cytoplasmic and membranous positivity.