ZNF746 Antibody

Name ZNF746 Antibody
Supplier Novus Biologicals
Catalog NBP2-13594
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: WNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGR TKGFGHKPGLKKHP
Purity/Format Immunogen affinity purified
Blocking Peptide ZNF746 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ZNF746
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.