ZNF665 Antibody
| Name | ZNF665 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13590 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VSLDISCKCVNTDLPPKGKNNMGEAFYTVKLERLESCDTVGLSFQEVQKN TYDFECQWKDD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF665 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF665 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ZNF665 Antibody [NBP2-13590] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3018_ZNF665-Antibody-Immunohistochemistry-NBP2-13590-img0003.jpg)
Immunohistochemistry: ZNF665 Antibody [NBP2-13590] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.