ZNF140 Antibody
| Name | ZNF140 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13553 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKREVKRDLFSVSESSGEIKDFSPKNVIYDDSSQYLIMERILSQGPVYSS FKGGWKCKDHTEMLQENQGCIRKVTVSHQEAL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF140 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZNF140 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ZNF140 Antibody [NBP2-13553] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20327_ZNF140-Antibody-Immunohistochemistry-Paraffin-NBP2-13553-img0001.jpg)
Immunohistochemistry-Paraffin: ZNF140 Antibody [NBP2-13553] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.