ZKSCAN2 Antibody
| Name | ZKSCAN2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13549 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVHLEKETGRLRQQVSSPVHREKHSPLGAAWEVADFQPEQVETQPRAVSR EEPGSLHSGHQEQLNRKRERR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZKSCAN2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZKSCAN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZKSCAN2 Antibody [NBP2-13549] - Staining of human cell line Hep G2 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26676_ZKSCAN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13549-img0002.jpg)
Immunocytochemistry/Immunofluorescence: ZKSCAN2 Antibody [NBP2-13549] - Staining of human cell line Hep G2 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: ZKSCAN2 Antibody [NBP2-13549] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26677_ZKSCAN2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13549-img0003.jpg)
Immunohistochemistry-Paraffin: ZKSCAN2 Antibody [NBP2-13549] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
![Immunohistochemistry-Paraffin: ZKSCAN2 Antibody [NBP2-13549] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26678_ZKSCAN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13549-img0001.jpg)
Immunohistochemistry-Paraffin: ZKSCAN2 Antibody [NBP2-13549] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.