ZDHHC2 Antibody
| Name | ZDHHC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13541 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZDHHC2 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZDHHC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ZDHHC2 Antibody [NBP2-13541] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9441_ZDHHC2-Antibody-Immunohistochemistry-NBP2-13541-img0002.jpg)
Immunohistochemistry: ZDHHC2 Antibody [NBP2-13541] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
![Simple Western: ZDHHC2 Antibody [NBP2-13541] - Simple Western lane view shows a specific band for ZDHHC2 in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9442_ZDHHC2-Antibody-Simple-Western-NBP2-13541-img0005.jpg)
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Simple Western lane view shows a specific band for ZDHHC2 in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: ZDHHC2 Antibody [NBP2-13541] - Electropherogram image(s) of corresponding Simple Western lane view. ZDHHC2 antibody was used at 1:20 dilution on Liver lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9443_ZDHHC2%2520Antibody-Simple%2520Western-NBP2-13541-img0006.jpg)
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Electropherogram image(s) of corresponding Simple Western lane view. ZDHHC2 antibody was used at 1:20 dilution on Liver lysate(s).