SUHW2 Antibody
| Name | SUHW2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13563 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSNNVHTSLSHVQNGAPFPAAFPKDNIHFKPINTNLDRENELAKTDILSL TSQKK |
| Description | Rabbit Polyclonal |
| Gene | ZNF280B |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SUHW2 Antibody [NBP2-13563] Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25093_SUHW2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13563-img0001.jpg)
Immunohistochemistry-Paraffin: SUHW2 Antibody [NBP2-13563] Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.