ZNF215 Antibody
| Name | ZNF215 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13560 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PQEAFIPETIYTEEEDFECSENKKSFDINSVSSICAIQVGIPSRKGSPKC DKFKTYFKFNLDSVGKQHSEYEYGNDLSLSTDIR |
| Description | Rabbit Polyclonal |
| Gene | ZNF215 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ZNF215 Antibody [NBP2-13560] Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25095_ZNF215%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13560-img0001.jpg)
Immunohistochemistry-Paraffin: ZNF215 Antibody [NBP2-13560] Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.