DEFB127 Antibody
| Name | DEFB127 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13911 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: TEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEACKKIT KPPRPKPATLALTLQDYVTIIENFPSLKTQST |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DEFB127 Protein |
| Description | Rabbit Polyclonal |
| Gene | DEFB127 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: DEFB127 Antibody [NBP2-13911] Staining of human stomach, upper shows moderate membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25122_DEFB127%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13911-img0001.jpg)
Immunohistochemistry-Paraffin: DEFB127 Antibody [NBP2-13911] Staining of human stomach, upper shows moderate membranous positivity in glandular cells.