DONSON Antibody
| Name | DONSON Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13931 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDP KLSSELRCTFQQSLIYWLHPALSWLPLFPRIG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DONSON Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DONSON |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DONSON Antibody [NBP2-13931] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25136_DONSON-Antibody-Immunohistochemistry-NBP2-13931-img0002.jpg)
Immunohistochemistry: DONSON Antibody [NBP2-13931] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.