Eukaryotic translation initiation factor 1 Antibody
| Name | Eukaryotic translation initiation factor 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13950 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKF ACNGTVIEHPEYGEVIQLQGDQRKNICQF |
| Description | Rabbit Polyclonal |
| Gene | EIF1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Eukaryotic translation initiation factor 1 Antibody [NBP2-13950] Staining of human tonsil shows strong cytoplasmic positivity in a subset of non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25146_Eukaryotic%2520translation%2520initiation%2520factor%25201%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13950-img0001.jpg)
Immunohistochemistry-Paraffin: Eukaryotic translation initiation factor 1 Antibody [NBP2-13950] Staining of human tonsil shows strong cytoplasmic positivity in a subset of non-germinal center cells.