FAM113A Antibody
| Name | FAM113A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13976 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRRMGGPCRQRLRHSER LIHTYKLDRRPPAHS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM113A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PCED1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM113A Antibody [NBP2-13976] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11270_FAM113A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13976-img0003.jpg)
Immunocytochemistry/Immunofluorescence: FAM113A Antibody [NBP2-13976] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: FAM113A Antibody [NBP2-13976] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11271_FAM113A-Antibody-Immunohistochemistry-Paraffin-NBP2-13976-img0001.jpg)
Immunohistochemistry-Paraffin: FAM113A Antibody [NBP2-13976] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.