FAM20A Antibody

Name FAM20A Antibody
Supplier Novus Biologicals
Catalog NBP2-13990
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: RHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKP MRQQRDEETPVDFFYFIDFQRH
Purity/Format Immunogen affinity purified
Blocking Peptide FAM20A Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene FAM20A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.