NIP30 Antibody
| Name | NIP30 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13988 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFK NMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NIP30 Protein |
| Description | Rabbit Polyclonal |
| Gene | FAM192A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NIP30 Antibody [NBP2-13988] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: MOLT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14791_NIP30-Antibody-Western-Blot-NBP2-13988-img0002.jpg)
Western Blot: NIP30 Antibody [NBP2-13988] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: MOLT-4
![Immunocytochemistry/Immunofluorescence: NIP30 Antibody [NBP2-13988] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14792_NIP30%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13988-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NIP30 Antibody [NBP2-13988] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: NIP30 Antibody [NBP2-13988] - Staining of human stomach shows moderate positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14793_NIP30-Antibody-Immunohistochemistry-Paraffin-NBP2-13988-img0001.jpg)
Immunohistochemistry-Paraffin: NIP30 Antibody [NBP2-13988] - Staining of human stomach shows moderate positivity in glandular cells.