FAM158A Antibody
| Name | FAM158A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13984 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWE ESRQMVGALLEDRAHQHLVDFDC |
| Description | Rabbit Polyclonal |
| Gene | EMC9 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: FAM158A Antibody [NBP2-13984] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25164_FAM158A%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13984-img0001.jpg)
Immunohistochemistry-Paraffin: FAM158A Antibody [NBP2-13984] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.