FBXL22 Antibody
| Name | FBXL22 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14011 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: HITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSL TELQKDNFLLGPALRSLSICWHS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FBXL22 Protein |
| Description | Rabbit Polyclonal |
| Gene | FBXL22 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FBXL22 Antibody [NBP2-14011] - Analysis in human uterus tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22439_FBXL22-Antibody-Western-Blot-NBP2-14011-img0003.jpg)
Western Blot: FBXL22 Antibody [NBP2-14011] - Analysis in human uterus tissue.
![Immunocytochemistry/Immunofluorescence: FBXL22 Antibody [NBP2-14011] - Staining of human cell line Hep G2 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22440_FBXL22-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14011-img0004.jpg)
Immunocytochemistry/Immunofluorescence: FBXL22 Antibody [NBP2-14011] - Staining of human cell line Hep G2 shows localization to cytosol.
![Immunohistochemistry-Paraffin: FBXL22 Antibody [NBP2-14011] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22441_FBXL22-Antibody-Immunohistochemistry-Paraffin-NBP2-14011-img0001.jpg)
Immunohistochemistry-Paraffin: FBXL22 Antibody [NBP2-14011] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.