FAM83E Antibody

Name FAM83E Antibody
Supplier Novus Biologicals
Catalog NBP2-14004
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: VPVYLLLDRQQLPAFLELAQQLGVNPWNTENVDVRVVRGCSFQSRWRRQV SGTVREKFVLLDGERVISGSYS
Purity/Format Immunogen affinity purified
Blocking Peptide FAM83E Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene FAM83E
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.