Gsh1 Antibody

Name Gsh1 Antibody
Supplier Novus Biologicals
Catalog NBP2-14076
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: SAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP
Purity/Format Immunogen affinity purified
Blocking Peptide Gsh1 Protein
Description Rabbit Polyclonal
Gene GSX1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.