KCNT2 Antibody

Name KCNT2 Antibody
Supplier Novus Biologicals
Catalog NBP2-14146
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSD HPLLRR
Purity/Format Immunogen affinity purified
Blocking Peptide KCNT2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene KCNT2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.