KANK3 Antibody
| Name | KANK3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14138 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGIL KSIMK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KANK3 Protein |
| Description | Rabbit Polyclonal |
| Gene | KANK3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KANK3 Antibody [NBP2-14138] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403679)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5835_KANK3-Antibody-Western-Blot-NBP2-14138-img0003.jpg)
Western Blot: KANK3 Antibody [NBP2-14138] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403679)
![Immunocytochemistry/Immunofluorescence: KANK3 Antibody [NBP2-14138] - Staining of human cell line U-2 OS shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5836_KANK3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14138-img0004.jpg)
Immunocytochemistry/Immunofluorescence: KANK3 Antibody [NBP2-14138] - Staining of human cell line U-2 OS shows localization to plasma membrane.
![Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules while cells in glomeruli exhibited strong membranous staining.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5837_KANK3-Antibody-Immunohistochemistry-Paraffin-NBP2-14138-img0001.jpg)
Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules while cells in glomeruli exhibited strong membranous staining.
![Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human spleen shows strong positivity in lymphatic tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5838_KANK3-Antibody-Immunohistochemistry-Paraffin-NBP2-14138-img0002.jpg)
Immunohistochemistry-Paraffin: KANK3 Antibody [NBP2-14138] - Staining of human spleen shows strong positivity in lymphatic tissue.