HUNK Antibody
| Name | HUNK Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14110 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQ PGPGSTGIPHKEDPLMLDMVRSFESVDR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HUNK Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HUNK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HUNK Antibody [NBP2-14110] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26114_HUNK%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14110-img0005.jpg)
Immunocytochemistry/Immunofluorescence: HUNK Antibody [NBP2-14110] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & plasma membrane.
![Immunohistochemistry-Paraffin: HUNK Antibody [NBP2-14110] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26115_HUNK-Antibody-Immunohistochemistry-Paraffin-NBP2-14110-img0004.jpg)
Immunohistochemistry-Paraffin: HUNK Antibody [NBP2-14110] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
![Immunohistochemistry: HUNK Antibody [NBP2-14110] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26116_HUNK-Antibody-Immunohistochemistry-NBP2-14110-img0002.jpg)
Immunohistochemistry: HUNK Antibody [NBP2-14110] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.