HSDL2 Antibody
| Name | HSDL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14104 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: IDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSK VAHILNISPPLNLNPVWFKQHC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HSDL2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HSDL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HSDL2 Antibody [NBP2-14104] - Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10072_HSDL2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14104-img0003.jpg)
Immunocytochemistry/Immunofluorescence: HSDL2 Antibody [NBP2-14104] - Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria.
![Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10073_HSDL2-Antibody-Immunohistochemistry-Paraffin-NBP2-14104-img0001.jpg)
Immunohistochemistry-Paraffin: HSDL2 Antibody [NBP2-14104] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.