HOGA1 Antibody
| Name | HOGA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14097 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQ VGADAAMVVTPCYYRGRMSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HOGA1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HOGA1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: HOGA1 Antibody [NBP2-14097] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1912_HOGA1-Antibody-Immunohistochemistry-NBP2-14097-img0002.jpg)
Immunohistochemistry: HOGA1 Antibody [NBP2-14097] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.