KRTHA2 Antibody
| Name | KRTHA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14175 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTF RPASCLSKTYLSSSCRAASGISGSM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KRTHA2 Protein |
| Description | Rabbit Polyclonal |
| Gene | KRT32 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: KRTHA2 Antibody [NBP2-14175] - Staining of human skin shows distinct positivity in hair follicle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25237_KRTHA2-Antibody-Immunohistochemistry-NBP2-14175-img0002.jpg)
Immunohistochemistry: KRTHA2 Antibody [NBP2-14175] - Staining of human skin shows distinct positivity in hair follicle.