Kirrel3/NEPH2 Antibody
| Name | Kirrel3/NEPH2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14161 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLT IVWMKRGSGVVLSNEKTLTLKSV |
| Blocking Peptide | Kirrel3/NEPH2 Protein |
| Description | Rabbit Polyclonal |
| Gene | KIRREL3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: KIRREL 3 Antibody [NBP2-14161] Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25240_KIRREL%25203%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14161-img0001.jpg)
Immunohistochemistry-Paraffin: KIRREL 3 Antibody [NBP2-14161] Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in glial cells.