LAPTM5 Antibody
| Name | LAPTM5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14183 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LAPTM5 Protein |
| Description | Rabbit Polyclonal |
| Gene | LAPTM5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20032_LAPTM5%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14183-img0001.jpg)
Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.