MMD2 Antibody
| Name | MMD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14238 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAA |
| Description | Rabbit Polyclonal |
| Gene | MMD2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: MMD2 Antibody [NBP2-14238] Staining of human stomach, lower shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25271_MMD2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14238-img0001.jpg)
Immunohistochemistry-Paraffin: MMD2 Antibody [NBP2-14238] Staining of human stomach, lower shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.