ADPRHL1 Antibody
| Name | ADPRHL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14269 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: NVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALT TDYWCLDDLYREMVRCYV |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ADPRHL1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ADPRHL1 Antibody [NBP2-14269] Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25288_ADPRHL1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14269-img0001.jpg)
Immunohistochemistry-Paraffin: ADPRHL1 Antibody [NBP2-14269] Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.