C11orf88 Antibody
| Name | C11orf88 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14372 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPS ESQLVL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C11orf88 Protein |
| Description | Rabbit Polyclonal |
| Gene | C11orf88 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: C11orf88 Antibody [NBP2-14372] Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25323_C11orf88%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14372-img0001.jpg)
Immunohistochemistry-Paraffin: C11orf88 Antibody [NBP2-14372] Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.