ATP5G2 Antibody

Name ATP5G2 Antibody
Supplier Novus Biologicals
Catalog NBP2-14331
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLK RPEILTDESLSSLAVSCPLTSLVSSRSFQ
Purity/Format Immunogen affinity purified
Blocking Peptide ATP5G2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ATP5G2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.