ARSH Antibody
| Name | ARSH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14319 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: HGFHYFYGVPFGLLSDCQASKTPELHRWLRIKL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ARSH Protein |
| Description | Rabbit Polyclonal |
| Gene | ARSH |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ARSH Antibody [NBP2-14319] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/5304_ARSH-Antibody-Immunohistochemistry-Paraffin-NBP2-14319-img0002.jpg)
Immunohistochemistry-Paraffin: ARSH Antibody [NBP2-14319] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.