HT021 Antibody
| Name | HT021 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14408 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKR NLSLLKDIEAAEKSL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HT021 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C3orf14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HT021 Antibody [NBP2-14408] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5933_HT021%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14408-img0004.jpg)
Immunocytochemistry/Immunofluorescence: HT021 Antibody [NBP2-14408] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: HT021 Antibody [NBP2-14408] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5934_HT021-Antibody-Immunohistochemistry-Paraffin-NBP2-14408-img0002.jpg)
Immunohistochemistry-Paraffin: HT021 Antibody [NBP2-14408] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.