V1b Vasopressin R/AVPR1B Antibody
| Name | V1b Vasopressin R/AVPR1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14338 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | V1b Vasopressin R/AVPR1B Protein |
| Description | Rabbit Polyclonal |
| Gene | AVPR1B |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: V1b Vasopressin R/AVPR1B Antibody [NBP2-14338] - Staining of human kidney shows distinct cytoplasmic positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25364_V1b-Vasopressin-R-AVPR1B-Antibody-Immunohistochemistry-NBP2-14338-img0002.jpg)
Immunohistochemistry: V1b Vasopressin R/AVPR1B Antibody [NBP2-14338] - Staining of human kidney shows distinct cytoplasmic positivity in tubular cells.