C12orf76 Antibody
| Name | C12orf76 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14515 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AEVKEEIVEKEMKKLVHSVFNMADYTFPLQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C12orf76 Protein |
| Description | Rabbit Polyclonal |
| Gene | C12orf76 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C12orf76 Antibody [NBP2-14515] - Staining of human kidney shows strong cytoplasmic positivity in subset of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25370_C12orf76-Antibody-Immunohistochemistry-NBP2-14515-img0002.jpg)
Immunohistochemistry: C12orf76 Antibody [NBP2-14515] - Staining of human kidney shows strong cytoplasmic positivity in subset of tubules.