CES7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-14472
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFG VS
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: CES7 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: CES5A
• Conjugate: Unconjugated

Product images

Western Blot: CES7 Antibody [NBP2-14472] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408085)

Immunohistochemistry-Paraffin: CES7 Antibody [NBP2-14472] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: CES7 Antibody [NBP2-14472] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.