NRK1 Antibody
| Name | NRK1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14426 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTD QESAEEIPILIIEGFLLFNYKPLDTIWNRS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NRK1 Protein |
| Description | Rabbit Polyclonal |
| Gene | NMRK1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NRK1 Antibody [NBP2-14426] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9082_NRK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14426-img0002.jpg)
Immunocytochemistry/Immunofluorescence: NRK1 Antibody [NBP2-14426] - Staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
![Immunohistochemistry-Paraffin: NRK1 Antibody [NBP2-14426] - Staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9083_NRK1-Antibody-Immunohistochemistry-Paraffin-NBP2-14426-img0003.jpg)
Immunohistochemistry-Paraffin: NRK1 Antibody [NBP2-14426] - Staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.