LRRC69 Antibody
| Name | LRRC69 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14566 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LIKALSGGKNTKIITLNGKKMTKMPSALGKLPGLKTLVLQNNLIPKVCPE LCNLTQFQDLKLREFYCEGNPLFLQQPVISTQQENVWSLQEIT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRC69 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRRC69 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: LRRC69 Antibody [NBP2-14566] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11264_LRRC69%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14566-img0003.jpg)
Immunocytochemistry/Immunofluorescence: LRRC69 Antibody [NBP2-14566] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
![Immunohistochemistry-Paraffin: LRRC69 Antibody [NBP2-14566] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11265_LRRC69-Antibody-Immunohistochemistry-Paraffin-NBP2-14566-img0001.jpg)
Immunohistochemistry-Paraffin: LRRC69 Antibody [NBP2-14566] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.