G-substrate Antibody
| Name | G-substrate Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13800 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPR RKDTPALH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | G-substrate Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPP1R17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-13800] Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4691_G-substrate%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13800-img0001.jpg)
Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-13800] Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.