PLCL2 Antibody
| Name | PLCL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13768 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSK IELKFKELHKSKDKAGTEVTKEEFIE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PLCL2 Protein |
| Description | Rabbit Polyclonal |
| Gene | PLCL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PLCL2 Antibody [NBP2-13768] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/232_PLCL2-Antibody-Immunohistochemistry-Paraffin-NBP2-13768-img0002.jpg)
Immunohistochemistry-Paraffin: PLCL2 Antibody [NBP2-13768] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.