PDZD9 Antibody
| Name | PDZD9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13748 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISISRDWHGYKKKN HTISVGKDINCDVMIHRDDKKEVRAPSPYWIMVKQDNESSSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PDZD9 Protein |
| Description | Rabbit Polyclonal |
| Gene | PDZD9 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PDZD9 Antibody [NBP2-13748] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25511_PDZD9%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13748-img0001.jpg)
Immunohistochemistry-Paraffin: PDZD9 Antibody [NBP2-13748] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.